HPA027135

SCP2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027135
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027135, RRID:AB_1856633
Product name
Anti-SCP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027135
Antibody type
Polyclonal
Antigen
Non-specific lipid-transfer protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIY
HSLGMTGIPIINVNNNCATGSTALFMARQLIQGGV
AECVLALGFEKMSKGSLGIKFSDRTIPTDKH
Storage
-20C
Provider Type Product Number
- No reagents -