HPA015605

SNX10 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015605
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015605, RRID:AB_1857342
Product name
Anti-SNX10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015605
Antibody type
Polyclonal
Antigen
Sorting nexin-10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRRYREFVWLRQRLQSNALLVQLPELPSKNLFFNM
NNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLF
LQSHLNSEDIEACVSGQTKYSVEEAIHKFALMNRR
FPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSH
GCKVNTAPQE
Storage
-20C
Provider Type Product Number
- No reagents -