HPA015605

SNX10 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015605
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015605, RRID:AB_1857342
Product name
Anti-SNX10
Provider product page
Atlas Antibodies - HPA015605
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRRYREFVWLRQRLQSNALLVQLPELPSKNLFFNM
NNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLF
LQSHLNSEDIEACVSGQTKYSVEEAIHKFALMNRR
FPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSH
GCKVNTAPQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -