HPA018110

SMPD2 antibody from Sigma-Aldrich
ISC1, nSMase
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018110
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018110, RRID:AB_1857292
Product name
Anti-SMPD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018110
Antibody type
Polyclonal
Antigen
Sphingomyelin phosphodiesterase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDF
LNQESFDLALLEEVWSEQDFQYLRQKLSPTYPAAH
HFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPY
Storage
-20C
Provider Type Product Number
- No reagents -