HPA018125

SMPD2 antibody from Atlas Antibodies
ISC1, nSMase
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018125
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018125, RRID:AB_1669941
Product name
Anti-SMPD2
Provider product page
Atlas Antibodies - HPA018125
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWT
GLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKP
FPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHR
GTPLSDHEALMATLFVRHSPPQQNPSST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -