Antibody data

Product number
H00000374-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000374-M06, RRID:AB_1571320
Product name
AREG monoclonal antibody (M06), clone 3E4
Provider product page
Abnova Corporation - H00000374-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AREG.
Antigen sequence
SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSR
SEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDN
EPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKP
KRKKK
Isotype
IgG
Antibody clone number
3E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -