HPA008720

AREG antibody from Atlas Antibodies
AREGB, SDGF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008720
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008720, RRID:AB_1844978
Product name
Anti-AREG
Provider product page
Atlas Antibodies - HPA008720
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSE
PSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVK
PPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKN
PCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGE
RC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -