HPA005803

CACNG4 antibody from Atlas Antibodies
MGC11138, MGC24983

Antibody data

Product number
HPA005803
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005803, RRID:AB_2667439
Product name
Anti-CACNG4
Provider product page
Atlas Antibodies - HPA005803
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHS
GLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEY
LLRIVRASSV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -