HPA065370

CACNG4 antibody from Atlas Antibodies
MGC11138, MGC24983

Antibody data

Product number
HPA065370
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA065370, RRID:AB_2685480
Product name
Anti-CACNG4
Provider product page
Atlas Antibodies - HPA065370
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLSREPLKVTTAASYSPDQEASFLQVHDFFQQDLK
EGFHVSMLNRRTTPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -