Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183546 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINH
FPEDN DYDHDSSEYL- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human neuronal stargazin-like proteins, gamma2, gamma3 and gamma4; an investigation of their specific localization in human brain and their influence on CaV2.1 voltage-dependent calcium channels expressed in Xenopus oocytes.
Moss FJ, Dolphin AC, Clare JJ
BMC neuroscience 2003 Sep 23;4:23
BMC neuroscience 2003 Sep 23;4:23
No comments: Submit comment
No validations: Submit validation data