HPA003531

OXA1L antibody from Atlas Antibodies
MGC133129, OXA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003531
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003531, RRID:AB_611682
Product name
Anti-OXA1L
Provider product page
Atlas Antibodies - HPA003531
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPRE
GFLESFKKGWKNAEMTRQLREREQRMRNQLELAAR
GPLRQTFTHNPLLQPGKDNPPNIPSSSSKPKSKYP
WHDTLG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -