HPA003531

OXA1L antibody from Sigma-Aldrich
MGC133129, OXA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003531
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003531, RRID:AB_1079539
Product name
Anti-OXA1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003531
Antibody type
Polyclonal
Antigen
Inner membrane protein OXA1L, mitochondrial precursor (Oxidase assembly 1-like protein) (OXA1-like protein) (OXA1Hs) (Hsa).
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPRE
GFLESFKKGWKNAEMTRQLREREQRMRNQLELAAR
GPLRQTFTHNPLLQPGKDNPPNIPSSSSKPKSKYP
WHDTLG
Storage
-20C
Provider Type Product Number
- No reagents -