Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310390 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Pannexin 1 (PANX1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PANX1 antibody: synthetic peptide directed towards the middle region of human PANX1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQC
KLIAV GIFQLLSVIN- Vial size
- 50 µg
Submitted references Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
No comments: Submit comment
No validations: Submit validation data