HPA016930

PANX1 antibody from Atlas Antibodies
MRS1, PX1, UNQ2529
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA016930
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016930, RRID:AB_1235083
Product name
Anti-PANX1
Provider product page
Atlas Antibodies - HPA016930
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENI
SEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIK
MDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETK
ANNGEKNARQRLLDSSC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -