HPA016930

PANX1 antibody from Atlas Antibodies
MRS1, PX1, UNQ2529
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA016930
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016930, RRID:AB_1854954
Product name
Anti-PANX1
Provider product page
Atlas Antibodies - HPA016930
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENI
SEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIK
MDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETK
ANNGEKNARQRLLDSSC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -