HPA017905

CSRNP3 antibody from MilliporeSigma / Merck KGaA
FAM130A2, FLJ32093, PPP1R73, TAIP-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017905
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017905, RRID:AB_1857757
Product name
Anti-CSRNP3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017905
Antibody type
Polyclonal
Antigen
TGF-beta-induced apoptosis protein 2 (TAIP-2) (Protein FAM130A2)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEDGSSFCSGVTDSSTQSLAPSESDEEEEEEEEEE
EEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDG
TAVHESHAKNAS
Storage
-20C
Provider Type Product Number
- No reagents -