HPA017905

CSRNP3 antibody from Atlas Antibodies
FAM130A2, FLJ32093, PPP1R73, TAIP-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017905
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017905, RRID:AB_1235829
Product name
Anti-CSRNP3
Provider product page
Atlas Antibodies - HPA017905
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEDGSSFCSGVTDSSTQSLAPSESDEEEEEEEEEE
EEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDG
TAVHESHAKNAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -