HPA017905

CSRNP3 antibody from Atlas Antibodies
FAM130A2, FLJ32093, PPP1R73, TAIP-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017905
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017905, RRID:AB_1857757
Product name
Anti-CSRNP3
Provider product page
Atlas Antibodies - HPA017905
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEDGSSFCSGVTDSSTQSLAPSESDEEEEEEEEEE
EEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDG
TAVHESHAKNAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -