HPA023119

PSMD12 antibody from Sigma-Aldrich
p55, Rpn5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023119
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023119, RRID:AB_1855845
Product name
Anti-PSMD12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023119
Antibody type
Polyclonal
Antigen
26S proteasome non-ATPase regulatory subunit 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLE
EIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGS
LESPATDVFGSTEEGEKRWKDLKNRVVEH
Storage
-20C
Provider Type Product Number
- No reagents -