HPA022010

NOL11 antibody from Atlas Antibodies
DKFZP586L0724
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022010
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022010, RRID:AB_2267158
Product name
Anti-NOL11
Provider product page
Atlas Antibodies - HPA022010
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRT
VILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGE
YVVVHDNKVLRIWNNEDVNL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -