HPA022010

NOL11 antibody from Sigma-Aldrich
DKFZP586L0724
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022010
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022010, RRID:AB_2267158
Product name
Anti-NOL11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022010
Antibody type
Polyclonal
Antigen
Nucleolar protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRT
VILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGE
YVVVHDNKVLRIWNNEDVNL
Storage
-20C
Provider Type Product Number
- No reagents -