H00008538-A01

BARX2 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00008538-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008538-A01, RRID:AB_463671
Product name
BARX2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00008538-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant BARX2.
Antigen sequence
PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKG
GQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQG
QEQLEPSQGQEELCEAQEPKARDVPLEMAE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.