H00008538-M01A

BARX2 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00008538-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008538-M01A, RRID:AB_1571644
Product name
BARX2 monoclonal antibody (M01A), clone 2B8
Provider product page
Abnova Corporation - H00008538-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant BARX2.
Antigen sequence
PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKG
GQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQG
QEQLEPSQGQEELCEAQEPKARDVPLEMAE
Isotype
IgG
Antibody clone number
2B8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -