Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486964 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-BarH-Like Homeobox 2 (BARHL2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BARHL2 antibody: synthetic peptide directed towards the middle region of human BARHL2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DREITSSRESPPVRAKKPRKARTAFSDHQLNQLER
SFERQ KYLSVQDRMD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Barhl1, a gene belonging to a new subfamily of mammalian homeobox genes, is expressed in migrating neurons of the CNS.
Bulfone A, Menguzzato E, Broccoli V, Marchitiello A, Gattuso C, Mariani M, Consalez GG, Martinez S, Ballabio A, Banfi S
Human molecular genetics 2000 May 22;9(9):1443-52
Human molecular genetics 2000 May 22;9(9):1443-52
No comments: Submit comment
No validations: Submit validation data