SAB2100204

BARX2 antibody from MilliporeSigma / Merck KGaA
No application information provided.

Antibody data

Product number
SAB2100204
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-BARX2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100204
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_003649.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKET
CDYFEKLSLYSVCPS
Storage
-20C