HPA008825

UXS1 antibody from Sigma-Aldrich
FLJ23591, SDR6E1, UGD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008825
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008825, RRID:AB_1858708
Product name
Anti-UXS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008825
Antibody type
Polyclonal
Antigen
UDP-glucuronic acid decarboxylase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MRSIQENGELKIESKIEEMVEPLREKIRDLEKSFT
QKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLM
MDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHD
V
Storage
-20C
Provider Type Product Number
- No reagents -