HPA008335

ATXN1 antibody from Sigma-Aldrich
ATX1, D6S504E, SCA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008335
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008335, RRID:AB_1845129
Product name
Anti-ATXN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008335
Antibody type
Polyclonal
Antigen
Ataxin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RAPGLITPGSPPPAQQNQYVHISSSPQNTGRTASP
PAIPVHLHPHQTMIPHTLTLGPPSQVVMQYADSGS
HFVPREATKKAESSRLQQAIQAKEVLNGEMEKSRR
YGAPSSADLGLGKAGGKSVPHP
Storage
-20C
Provider Type Product Number
- No reagents -