Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008038-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008038-M01, RRID:AB_509218
- Product name
- ADAM12 monoclonal antibody (M01), clone 1G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ADAM12.
- Antigen sequence
ETLKATKYVELVIVADNREFQRQGKDLEKVKQRLI
EIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQ
DPFTSLHEFLDWRKMKLLPRKSHDNAQ- Isotype
- IgG
- Antibody clone number
- 1G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.
Zhou Z, Ran YL, Hu H, Pan J, Li ZF, Chen LZ, Sun LC, Peng L, Zhao XL, Yu L, Sun LX, Yang ZH
Clinical & experimental metastasis 2008;25(5):537-48
Clinical & experimental metastasis 2008;25(5):537-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ADAM12 expression in transfected 293T cell line by ADAM12 monoclonal antibody (M01), clone 1G3.Lane 1: ADAM12 transfected lysate (Predicted MW: 80.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ADAM12 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol