HPA013920

SKIL antibody from Sigma-Aldrich
SNO, SnoA, SnoN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013920
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013920, RRID:AB_1856935
Product name
Anti-SKIL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013920
Antibody type
Polyclonal
Antigen
Ski-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTSRELCSRLDASISNNSTSKRKSESATCNLVRDI
NKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMR
TYLKQQEKLNLILQKKQQLQMEVKMLSSSKSMKEL
TEEQQNLQKELESLQNEHAQRMEEFYVEQKD
Storage
-20C
Provider Type Product Number
- No reagents -