ABIN633203

NELFE antibody from antibodies-online
D6S45, NELF-E, RD, RDBP, RDP

Antibody data

Product number
ABIN633203
Provider
antibodies-online
Product name
anti-RD RNA Binding Protein (RDBP) (N-Term) antibody
Provider product page
antibodies-online - ABIN633203
Antibody type
Polyclonal
Antigen
RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS
Description
Affinity purified
Reactivity
Human, Mouse
Host
Rabbit
Epitope
N-Term
Vial size
50 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Provider Type Product Number
- No reagents -