HPA007187

NELFE antibody from Atlas Antibodies

D6S45, NELF-E, RD, RDBP, RDP

Western blot: Enhanced validation

Immunohistochemistry: Enhanced validation

Provider product page for HPA007187

Antibody data

Antibody Data
References [0]
Comments [0]
Validations
Western blot [2]
Immunohistochemistry [6]

Submit

Validation data

Product number: HPA007187
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA007187, RRID:AB_1856161
Product name: Anti-NELFE
Provider product page: Atlas Antibodies - HPA007187
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATE QAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKD PEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLY ESFVSSSDRLRELGPDG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows weak to moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA007187 antibody. Corresponding NELFE RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more