HPA007187

NELFE antibody from Sigma-Aldrich
D6S45, NELF-E, RD, RDBP, RDP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007187
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007187, RRID:AB_1856161
Product name
Anti-RDBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007187
Antibody type
Polyclonal
Antigen
Negative elongation factor E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATE
QAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKD
PEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLY
ESFVSSSDRLRELGPDG
Storage
-20C
Provider Type Product Number
- No reagents -