HPA023299

AMZ2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023299
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023299, RRID:AB_2226909
Product name
Anti-AMZ2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023299
Antibody type
Polyclonal
Antigen
Archaemetzincin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPE
APQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNT
RIIS
Storage
-20C
Provider Type Product Number
- No reagents -