HPA007596

CRLF3 antibody from Sigma-Aldrich
CREME9, CYTOR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007596
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007596, RRID:AB_1847241
Product name
Anti-CRLF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007596
Antibody type
Polyclonal
Antigen
Cytokine receptor-like factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTK
KASHIQLDSLPEVPLLVDVPCLSAQLDDSILNIVK
DHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVD
DDFTAQDYRLQFRKCTSNHFEDVYVGSE
Storage
-20C
Provider Type Product Number
- No reagents -