HPA023245

ARSG antibody from Sigma-Aldrich
KIAA1001
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023245
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023245, RRID:AB_1845056
Product name
Anti-ARSG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023245
Antibody type
Polyclonal
Antigen
Arylsulfatase G Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHD
MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDV
ALPLYENLNIVEQPV
Storage
-20C
Provider Type Product Number
- No reagents -