HPA007974

FGD6 antibody from Sigma-Aldrich
FLJ11183, ZFYVE24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007974
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007974, RRID:AB_1848520
Product name
Anti-FGD6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007974
Antibody type
Polyclonal
Antigen
FYVE, RhoGEF and PH domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALKHYLLKPVQRIPQYRLLLTDYLKNLIEDAGDYR
DTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYS
LNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFL
FNDALLYTTPVQSGMYKLNNMLSLAGMKVRKPTQE
A
Storage
-20C
Provider Type Product Number
- No reagents -