HPA007436

EVI2B antibody from Atlas Antibodies
CD361, D17S376, EVDB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007436
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007436, RRID:AB_1848307
Product name
Anti-EVI2B
Provider product page
Atlas Antibodies - HPA007436
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETPDICMDNIRENEISTKRTSIISLTPWKPSKSTL
LADDLEIKLFESSENIEDSNNPKTEKIKDQVNGTS
EDSADGSTVGTAVSSSDDADLPPPPPLLDLEGQES
NQSDKPTMTIVSPLPNDSTSLPPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -