HPA007436

EVI2B antibody from Sigma-Aldrich
CD361, D17S376, EVDB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007436, RRID:AB_1848307
Product name
Anti-EVI2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007436
Antibody type
Polyclonal
Antigen
Protein EVI2B Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETPDICMDNIRENEISTKRTSIISLTPWKPSKSTL
LADDLEIKLFESSENIEDSNNPKTEKIKDQVNGTS
EDSADGSTVGTAVSSSDDADLPPPPPLLDLEGQES
NQSDKPTMTIVSPLPNDSTSLPPS
Storage
-20C
Provider Type Product Number
- No reagents -