Antibody data

Product number
H00006819-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006819-B02P, RRID:AB_1581113
Product name
SULT1C2 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00006819-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SULT1C2 protein.
Antigen sequence
MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSF
EAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEK
CQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRI
LKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSY
YHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFD
HVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQ
FMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVS
KSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEI
YRRKMEGTSINFCMEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -