HPA007190

SULT1C2 antibody from Atlas Antibodies
ST1C1, SULT1C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007190
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007190, RRID:AB_1235781
Product name
Anti-SULT1C2
Provider product page
Atlas Antibodies - HPA007190
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQE
IVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPS
GVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFL
YVARNAKDCMVSYYHFQRMNH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -