HPA007190

SULT1C2 antibody from Sigma-Aldrich
ST1C1, SULT1C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007190
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007190, RRID:AB_1857647
Product name
Anti-SULT1C2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007190
Antibody type
Polyclonal
Antigen
Sulfotransferase 1C2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQE
IVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPS
GVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFL
YVARNAKDCMVSYYHFQRMNH
Storage
-20C
Provider Type Product Number
- No reagents -