HPA025826

MRPL37 antibody from Atlas Antibodies
MRP-L2, RPML2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025826
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025826, RRID:AB_1854106
Product name
Anti-MRPL37
Provider product page
Atlas Antibodies - HPA025826
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SATWNRESLLLQVRGSGGARLSTKDPLPTIASREE
IEATKNHVLETFYPISPIIDLHECNIYDVK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -