HPA025767

MRPL37 antibody from Sigma-Aldrich
MRP-L2, RPML2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025767
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025767, RRID:AB_1854105
Product name
Anti-MRPL37 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025767
Antibody type
Polyclonal
Antigen
39S ribosomal protein L37, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQL
LYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLA
LYLHGA
Storage
-20C
Provider Type Product Number
- No reagents -