HPA008607

DOCK7 antibody from Sigma-Aldrich
KIAA1771, ZIR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008607
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008607, RRID:AB_1847821
Product name
Anti-DOCK7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008607
Antibody type
Polyclonal
Antigen
Dedicator of cytokinesis protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMF
ELSVPFRQQHYLAGLVLTELAVILDPDAEGLFGLH
KKVINMVHNLLSSHDSDPRYSDPQIKARVAMLYLP
LIGIIMETVPQLYDFTETH
Storage
-20C
Provider Type Product Number
- No reagents -