HPA022872

JAKMIP3 antibody from Atlas Antibodies
bA140A10.5, C10orf14, C10orf39, FLJ37857, KIAA4091, NECC2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022872
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022872, RRID:AB_2249331
Product name
Anti-JAKMIP3
Provider product page
Atlas Antibodies - HPA022872
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IQARTVLTLAEKWLQQIEETEAALQRKMVDLESEK
ELFSKQKGYLDEELDYRKQALDQANKHILELEAML
YDALQQEAGAKVAELLSEEEREKLKVAVEQWKRQV
MSELRERDAQILRERMELLQLAQQRIKELEERIEA
QKRQIKELEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -