HPA003873

LTB4R antibody from Atlas Antibodies
BLTR, CMKRL1, GPR16, LTB4R1, P2RY7, P2Y7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003873, RRID:AB_611340
Product name
Anti-LTB4R
Provider product page
Atlas Antibodies - HPA003873
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAA
LEPGPSESLTASSPLKLNE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -