HPA010122

DLG4 antibody from Sigma-Aldrich
PSD-95, PSD95, SAP-90, SAP90
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010122
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010122, RRID:AB_1855169
Product name
Anti-DLG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010122
Antibody type
Polyclonal
Antigen
Disks large homolog 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDY
DKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQAR
RVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGS
SSGSQGREDSVLSYETVTQMEVHYAR
Storage
-20C
Provider Type Product Number
- No reagents -