HPA012393

ADGRA2 antibody from Sigma-Aldrich
DKFZp434C211, DKFZp434J0911, FLJ14390, GPR124, KIAA1531, TEM5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012393
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012393, RRID:AB_1849256
Product name
Anti-GPR124 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012393
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 124 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTS
AAPLSEAGRAGQRRSASRDSLKGGGALEKESHRRS
YPLNAASLNGAPKGGKYDDVTLMGAEVASGGCMKT
GLWK
Storage
-20C
Provider Type Product Number
- No reagents -