HPA017894

STK32C antibody from Sigma-Aldrich
MGC23665, PKE, YANK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017894
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017894, RRID:AB_1857591
Product name
Anti-STK32C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017894
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 32C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSS
QSENDYLQDCLDAIQQDFVIFNREKLKRSQDLPRE
PLPAPESRDAAEPVEDEAERSALPMCGPICPS
Storage
-20C
Provider Type Product Number
- No reagents -