H00010758-M01
antibody from Abnova Corporation
Targeting: TRAF3IP2
ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CIKS, DKFZP586G0522
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010758-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010758-M01, RRID:AB_464245
- Product name
- TRAF3IP2 monoclonal antibody (M01), clone 4A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRAF3IP2.
- Antigen sequence
LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLH
TKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHV
PTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRG
PLPTLQVVPL- Isotype
- IgG
- Antibody clone number
- 4A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRAF3IP2 monoclonal antibody (M01), clone 4A3 Western Blot analysis of TRAF3IP2 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRAF3IP2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TRAF3IP2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TRAF3IP2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol