PAB20460

ADGRA3 antibody from Abnova Corporation
FLJ38547, GPR125, PGR21

Antibody data

Product number
PAB20460
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20460, RRID:AB_10967682
Product name
GPR125 polyclonal antibody
Provider product page
Abnova Corporation - PAB20460
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GPR125.
Antigen sequence
DIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRS
LEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVY
PKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHR
QVVFEGDSLPFQCMASYIDQDMQVLWYQDGRI
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -