HPA008904

ADGRA3 antibody from Sigma-Aldrich
FLJ38547, GPR125, PGR21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008904
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008904, RRID:AB_1849258
Product name
Anti-GPR125 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008904
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 125 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRS
LEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVY
PKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHR
QVVFEGDSLPFQCMASYIDQDMQVLWYQDGRI
Storage
-20C
Provider Type Product Number
- No reagents -